Transcript | Ll_transcript_262056 |
---|---|
CDS coordinates | 83-691 (+) |
Peptide sequence | MASSFSIATPTTLTNVPELIIRNRACFNRNPNVSMRGFHNQPRLNLNLNTNGRSPTLRNKGFSSLVVRASTEEAVVPQSKVTHKVYFDISIGNPVGKLAGRIVIGLFGDDVPQTVENFRALATGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNVRALLFFLLSCYYLNFYIPFFVFCRLNLVITIFIAGYWRQKYIWSYFQR* |
ORF Type | complete |
Blastp | Photosynthetic NDH subunit of lumenal location 5, chloroplastic from Arabidopsis with 82.76% of identity |
---|---|
Blastx | Photosynthetic NDH subunit of lumenal location 5, chloroplastic from Arabidopsis with 82.76% of identity |
Eggnog | PPIases accelerate the folding of proteins (By similarity)(ENOG410Z0G4) |
Kegg | Link to kegg annotations (AT5G13120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428470.1) |
Pfam | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer