Protein coding transcript 14275

• Transcript: Ll_transcript_323696
• CDS coordinates: 195-1088 (+)
• Peptide sequence: MGVEEGVPAALGFHMPAEWERHSHCWMGWPERCDNWRDNAIHAQRLFTTVASAISAFEPVTICASSSQWENARNQLPLHIRVVEISMNDSWFRDTGPTFVVRRNPSEPGDEHHPIAGIDWTFNSWGGVEDGCYSDWSQDTLVARKILEIEKIPKFPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLSKSQIEDELKAYLGIRKVIWLPHGLYGDDDTNGHIDNMCCFVRPGVVLLSWTDDETDPQYERSVEAYSLLSSVTDANNRKLEIIKLHVPGPLYMTEEEAAGVFQVKF*
• ORF Type: complete

Annotations of Ll_transcript_323696

• Blastp: Agmatine deiminase from Arabidopsis with 71.43% of identity
• Blastx: Agmatine deiminase from Arabidopsis with 71.43% of identity
• Eggnog: Agmatine deiminase(COG2957)
• Kegg: Link to kegg annotations (AT5G08170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439055.1)
• Pfam: Porphyromonas-type peptidyl-arginine deiminase (PF04371.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;