Protein coding transcript 142750

• Transcript: Ll_transcript_261892
• CDS coordinates: 254-1357 (+)
• Peptide sequence: MKLSLSSVYTPYSFPIILKSYAFSNLCKPFCSSALSSSPPISLKPQVPLFLRPPIYSTKFCDFKKWHDWAKGIASSIGSTFVNSDNGPDSSILCRELKWLMEDAVEDHSLFSKMGFENYDERVKMRVGIEELYDLWKERIEKRRPFQYVVGCEHWRDLVLSVQEGVLIPRPETELIVDFVCDVVSKNEDLKRGVWADLGTGSGALAIGIGGASGIGGRVIATDINPVSVAVAAYNVQRYCLQDKIEVREGSWFEPLKDIEGKLAGLVSNPPYIPSKEISGLQAEVGRHEPRVALDGGIDGMDYLFHLCDGAALFLKPGGYFAFETNGEQQCRALVDYMKNKRSESLCNFEIVADFAGIQRFVIGFHH*
• ORF Type: complete

Annotations of Ll_transcript_261892

• Blastp: Release factor glutamine methyltransferase from Thermosynechococcus with 33.44% of identity
• Blastx: Release factor glutamine methyltransferase from Thermosynechococcus with 33.44% of identity
• Eggnog: Methylates the class 1 translation termination release factors RF1 PrfA and RF2 PrfB on the glutamine residue of the universally conserved GGQ motif (By similarity)(COG2890)
• Kegg: Link to kegg annotations (tlr1836)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443714.1)
• Pfam: Protein of unknown function (DUF890) (PF05971.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;