Protein coding transcript 1428

• Transcript: Ll_transcript_503184
• CDS coordinates: 1-345 (+)
• Peptide sequence: EKYEPHYDYSHHKFNQQFGGYRIATLLMYLSNVEKGGETIFPNSDPTFSQPMDESWSECARKGYAVKPEKGDALLFFSLFPNATTDTRSLHGSCPVIKGEKWSATKWIHVRDFDN
• ORF Type: internal

Annotations of Ll_transcript_503184

• Blastp: Probable prolyl 4-hydroxylase 7 from Arabidopsis with 68.42% of identity
• Blastx: Probable prolyl 4-hydroxylase 7 from Arabidopsis with 68.42% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G28480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419538.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF13640.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;