Protein coding transcript 14303

• Transcript: Ll_transcript_469473
• CDS coordinates: 68-958 (+)
• Peptide sequence: MNHYSVRRTAVAVMSRCYSSTVAKKISKPIPRPKEIPFQPRASNSVKLVGKVIMPVQFQTGSDGSHWASTVISREHSSSHHVWIPVIFEGDLAHTALSHLKPDDFIHIAGHLITDPPHFPIHLHNTHTNVQVMVKSLNFVQGYPVENNDASSTSSENEKDEINQPGEDFNSKENEENDVDEPWKDLLLNPSEWWDVRPTKENSKGAAFERKTSGDLLFINSSTPKWLEEKLELLTFDLKPESENSASGAKKNSAPNFIAWRDLLQDPKQWFDFRDSKNSGLVVIDDLSLSVKFLSD*
• ORF Type: complete

Annotations of Ll_transcript_469473

• Blastp: Protein OSB2, chloroplastic from Arabidopsis with 38.7% of identity
• Blastx: Protein OSB3, chloroplastic/mitochondrial from Arabidopsis with 39.29% of identity
• Eggnog: single-stranded dna binding protein(ENOG410YJP5)
• Kegg: Link to kegg annotations (AT4G20010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458978.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;