Transcript | Ll_transcript_469474 |
---|---|
CDS coordinates | 68-1513 (+) |
Peptide sequence | MNHYSVRRTAVAVMSRCYSSTVAKKISKPIPRPKEIPFQPRASNSVKLVGKVIMPVQFQTGSDGSHWASTVISREHSSSHHVWIPVIFEGDLAHTALSHLKPDDFIHIAGHLITDPPHFPIHLHNTHTNVQVMVKSLNFVQGYPVENNDASSTSSENEKDEINQPGEDFNSKENEENDVDEPWKDLLLNPSEWWDVRPTKENSKGAAFERKTSGDLLFINSSTPKWLEEKLELLTFDLKPESENSASGAKKNSAPNFIAWRDLLQDPKQWFDFRDSKNSGLVTTKFPDFKRKDGSLSIWLDGTPKWVLPKLEALEIDVPVVKPKQANAGDESWNDLLNNPNKWWDNRSNKKNEKGPDFKNKETGEALWVDGAPKWFFSKLDSTEIDVSIVESKQATTSKGDESWNDLLNNPNKWWDNRSNKKNEKGPDFKNKETGEALWVNGAPKWVLSELDRTEIDIPIVESEQATSGTDPNLVKPVFVI* |
ORF Type | complete |
Blastp | Protein OSB3, chloroplastic/mitochondrial from Arabidopsis with 40.75% of identity |
---|---|
Blastx | Protein OSB3, chloroplastic/mitochondrial from Arabidopsis with 40.75% of identity |
Eggnog | single-stranded DNA-binding protein(ENOG410YC5C) |
Kegg | Link to kegg annotations (AT5G44785) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458978.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer