Protein coding transcript 1431

• Transcript: Ll_transcript_459443
• CDS coordinates: 2-526 (+)
• Peptide sequence: PKQSVAVIKNGTTTTQYCGIVKKNEKVQKNARVVLVMDHCKKMQCWVMLKRLMTGKDSWVFKEPLMGLEILDKDYSIDNSSKSKPFIKSQIVHNQSQIKKPTCLKDIESKLNKLLYTNPDEFANDIRDILSYGLLHPPRNDIYKIARRVSNDFEVSWKSLKEKWLSGEGKGKKN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_459443

• Blastp: Transcription factor GTE12 from Arabidopsis with 32.23% of identity
• Blastx: Transcription factor GTE12 from Arabidopsis with 32.23% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT5G46550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006586594.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;