Protein coding transcript 143179

• Transcript: Ll_transcript_11826
• CDS coordinates: 2309-2731 (+)
• Peptide sequence: MAGYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFIISIVNIVIWLGVGGIWWKAIGLW*
• ORF Type: complete

Annotations of Ll_transcript_11826

• Blastp: Dicarboxylate transporter 1, chloroplastic from Arabidopsis with 90.71% of identity
• Blastx: Dicarboxylate transporter 1, chloroplastic from Arabidopsis with 89.21% of identity
• Eggnog: Transporter(COG0471)
• Kegg: Link to kegg annotations (AT5G12860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448317.1)
• Pfam: Sodium:sulfate symporter transmembrane region (PF00939.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;