Transcript | Ll_transcript_12268 |
---|---|
CDS coordinates | 13-891 (+) |
Peptide sequence | MSHSLSSLHRISLFMATKPQRLHQTVAGTNLQNSAKRARTMATSSEATNESSPMKDAFTKYAQYLNDLNDKRERVVKASRDITMNSKKVIFQVHRLSKYNRDEVLEKAEKDLAAVTDQYISRLVRELQGTDFWKLRRAYSPGIQEYVEAATFCSFCKNGTLLKLDEINNTLLPLSDPSIEPLQINILDYLLGIADLTGELMRLAIGRISDGELEFAEKICRFARDIYRELTLVVPHMDASSDMKTKMDTMLQSVMKIENACFSVRVRGSEYIPLLGSNDPSSFLVGVPDIEL* |
ORF Type | complete |
Blastp | Translin-associated protein X from Macaca with 38.68% of identity |
---|---|
Blastx | Translin-associated protein X from Macaca with 38.68% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101866421) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423339.1) |
Pfam | Translin family (PF01997.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer