| Transcript | Ll_transcript_12270 |
|---|---|
| CDS coordinates | 213-551 (+) |
| Peptide sequence | MEMKHTAHMQFRSAFSAPSNKKMLNVLLQIADLTGELMRLAIGRISDGELEFAEKICRFARDIYRELTLVVPHMDASSDMKTKMDTMLQSVMKIENGIRFQNTVCKTNVSIY* |
| ORF Type | complete |
| Blastp | Translin-associated protein X from Pongo with 31.51% of identity |
|---|---|
| Blastx | - |
| Eggnog | translin(COG2178) |
| Kegg | Link to kegg annotations (100172282) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423344.1) |
| Pfam | Translin family (PF01997.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer