Transcript | Ll_transcript_12272 |
---|---|
CDS coordinates | 213-551 (+) |
Peptide sequence | MEMKHTAHMQFRSAFSAPSNKKMLNVLLQIADLTGELMRLAIGRISDGELEFAEKICRFARDIYRELTLVVPHMDASSDMKTKMDTMLQSVMKIENGIRFQNTVCKTNVSIY* |
ORF Type | complete |
Blastp | Translin-associated protein X from Pongo with 31.51% of identity |
---|---|
Blastx | - |
Eggnog | translin(COG2178) |
Kegg | Link to kegg annotations (100172282) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423344.1) |
Pfam | Translin family (PF01997.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer