Transcript | Ll_transcript_11792 |
---|---|
CDS coordinates | 595-1104 (+) |
Peptide sequence | MPTYYNQVLKFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSKGVSITSVRKIMQSIGFLGPAFFLTQLSHVKTPVMAVLCMACSQGCDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWNDVFKVSVALYLIGTLVWNIFSTGEKILD* |
ORF Type | complete |
Blastp | Ascorbate transporter, chloroplastic from Arabidopsis with 93.49% of identity |
---|---|
Blastx | Ascorbate transporter, chloroplastic from Arabidopsis with 91.38% of identity |
Eggnog | solute carrier family 17(ENOG410XPWC) |
Kegg | Link to kegg annotations (AT4G00370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430051.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer