Protein coding transcript 143367

• Transcript: Ll_transcript_11784
• CDS coordinates: 1364-2305 (+)
• Peptide sequence: MRAFMGIGEGVAMPAMNNMISKWVPVSERSRSLALVYSGMYLGSVTGLAFSPLLIQKFGWPSVFYSFGSLGSVWFALWLRKAYSSPKDDPDLGTEEKRLILEGSVSKEPVTVIPWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTMAIFANIGGWIADTLVSKGVSITSVRKIMQSIGFLGPAFFLTQLSHVKTPVMAVLCMACSQGCDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWNDVFKVSVALYLIGTLVWNIFSTGEKILD*
• ORF Type: complete

Annotations of Ll_transcript_11784

• Blastp: Ascorbate transporter, chloroplastic from Arabidopsis with 90.73% of identity
• Blastx: Ascorbate transporter, chloroplastic from Arabidopsis with 89.61% of identity
• Eggnog: solute carrier family 17(ENOG410XPWC)
• Kegg: Link to kegg annotations (AT4G00370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430051.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;