Protein coding transcript 143470

• Transcript: Ll_transcript_12320
• CDS coordinates: 141-500 (+)
• Peptide sequence: MAFHRAIFVCFQGNTISTPAIKGTILPGITRKSIIDLARSQGFQVEERLVSVDELVDADEVFCTGTAVVVSPVGSVTHLGKRISYGNGVGAVTRQLHASLTRLQMGLIADEMNWTLELR*
• ORF Type: complete

Annotations of Ll_transcript_12320

• Blastp: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 75.22% of identity
• Blastx: Branched-chain amino acid aminotransferase 2, chloroplastic from Humulus with 75.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017427724.1)
• Pfam: Amino-transferase class IV (PF01063.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;