Transcript | Ll_transcript_12193 |
---|---|
CDS coordinates | 253-993 (+) |
Peptide sequence | MQCVKSSQSFTLPHGWFIEEKPRPYNPNIKDRYYYEPGTGRKFRSLLSVQRYLTQGIIEDRCRTNGTIIPRNQNTMQVITHNRENASFIELPNDWIVKKKPRNNNYAVGVTNMTDIEPGTGRQFRSLKAVERYLAGGNGCTAITKSRVKPRTGLQHSSITEEEEITLKALKHSTKSTHCKVFDSPTELNPGTDNRACMHNLSKPPAKVKWVLSGSGGCWNPFLDDSDVPDSEKLKWSEAFVLSINS* |
ORF Type | complete |
Blastp | Methyl-CpG-binding domain-containing protein 7 from Arabidopsis with 34.31% of identity |
---|---|
Blastx | Methyl-CpG-binding domain-containing protein 7 from Arabidopsis with 34.18% of identity |
Eggnog | Methyl-CpG binding domain protein(ENOG4111HPQ) |
Kegg | Link to kegg annotations (AT5G59800) |
CantataDB | Link to cantataDB annotations (CNT0002360) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436225.1) |
Pfam | Methyl-CpG binding domain (PF01429.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer