Protein coding transcript 143493

• Transcript: Ll_transcript_12197
• CDS coordinates: 1163-1570 (+)
• Peptide sequence: MQTDIEPGTGRQFRSLKAVERYLAGGNGCTAITKSRVKPRTGLQHSSITEEEEITLKALKHSTKSTHCKVFDSPTELNPGTDNRACMHNLSKPPAKVKWVLSGSGGCWNPFLDDSDVPDSEKLKWSEAFVLSINS*
• ORF Type: complete

Annotations of Ll_transcript_12197

• Blastp: Methyl-CpG-binding domain-containing protein 7 from Arabidopsis with 34.65% of identity
• Blastx: Methyl-CpG-binding domain-containing protein 7 from Arabidopsis with 34.65% of identity
• Eggnog: Methyl-CpG binding domain protein(ENOG4111HPQ)
• Kegg: Link to kegg annotations (AT5G59800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436225.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;