Transcript | Ll_transcript_459486 |
---|---|
CDS coordinates | 3-311 (+) |
Peptide sequence | LGKPKEAYNTLQQTGVSFLGGYIAGIGCATISHPADVMVSKRNAERKPGESAGKAMGRIYQNIGFKGLWNGLPVRIGMIGTLTAFQWLIYDSFKVYLGLPTTG |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Mitochondrial phosphate carrier protein 2 from Saccharomyces with 72.82% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YER053C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426696.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer