Protein coding transcript 143523

• Transcript: Ll_transcript_109310
• CDS coordinates: 252-908 (+)
• Peptide sequence: MNENRNLKRPRSPPFKMPLTDSNNVQDIDDSILFPVEEIVQYPLPGYVSPTSVTFSPDDTLISYLFSPDQTLNRKIFSFDLKTNKQELLFSPPDGGLDESNISPEEKLRRERLRERGLGVTRYEWVKTSSKRKVVMVPLPAGIYIQDVSNSKVELKLPSISGSPIIDPHLSPDGSMLAYVRDSELHVLNLLTNESKQLTNGAKENGLVSSIIVWSLLC*
• ORF Type: complete

Annotations of Ll_transcript_109310

• Blastp: Dipeptidyl aminopeptidase 4 from Pseudoxanthomonas with 29.38% of identity
• Blastx: -
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417130.1)
• Pfam: Dipeptidyl peptidase IV (DPP IV) N-terminal region (PF00930.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;