Protein coding transcript 143526

• Transcript: Ll_transcript_109313
• CDS coordinates: 393-1043 (+)
• Peptide sequence: MTRSSIEKSCLCLFLTSFLVSSFQVNYCFSCLQLDNRGTSRRGLKFESYFKHKLGQVDADDQVTGAEWLIKKGLAKAGHIGLYGWSYGGYLSAMALSRYPDFFKCAVAGAPVTSWDGYDTFYTEKYMGLPSENQAGYESGSVMNHVHKLKGKLLLVHGMIDENVHFRHTARLINGLVAAGKPYELIVFPDERHMPRRHRDRVYMEERIWDFIQRNL*
• ORF Type: complete

Annotations of Ll_transcript_109313

• Blastp: Dipeptidyl peptidase 9 from Mus with 46.35% of identity
• Blastx: Dipeptidyl peptidase 8 from Homo with 45.31% of identity
• Eggnog: peptidase s9 prolyl oligopeptidase active site domain protein(COG1506)
• Kegg: Link to kegg annotations (224897)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417131.1)
• Pfam: Prolyl oligopeptidase family (PF00326.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;