Protein coding transcript 143605

• Transcript: Ll_transcript_109384
• CDS coordinates: 846-1748 (+)
• Peptide sequence: MILKLMQGFFGTTSEVSEPDGLTKKGKTTKGTKRYMPQRNSVAYALLITLYRGTSNGNEFMRKQELIDAAEASGLSRVPILPEKGKGKPGHFGSSPREWYSGWSCMKTLVTKGLVVRSSCPAKYMLTQEGKEAACDCLKRSGMTESLEKSVSVEISSYIDKQNSLDKELEGHDSESEVMSPLTQQKKPMGVPLDSLERFTRMGYSKEQIVSAFTEVSRSYPNKDVSSLWPAVLCHLRGEQVYGPQPELQTNINNCHMISGSSDLIGNERRTVSSSRGGHVSNSRSLDIPSFPLRACSSNS*
• ORF Type: complete

Annotations of Ll_transcript_109384

• Blastp: Crossover junction endonuclease MUS81 from Arabidopsis with 51.55% of identity
• Blastx: Crossover junction endonuclease MUS81 from Arabidopsis with 71.64% of identity
• Eggnog: Excision repair cross-complementing rodent repair deficiency, complementation group 4(COG1948)
• Kegg: Link to kegg annotations (AT4G30870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427613.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;