Transcript | Ll_transcript_109388 |
---|---|
CDS coordinates | 2-301 (+) |
Peptide sequence | GVGKMILKLMQGFFGTTSEVSEPDGLTKKGKTTKGTKRYMPQRNSVAYALLITLYRGTSNGNEFMRKQELIDAAEASGLSRVPILYVQHSFFIILFVFN* |
ORF Type | 5prime_partial |
Blastp | Crossover junction endonuclease MUS81 from Arabidopsis with 61.63% of identity |
---|---|
Blastx | Crossover junction endonuclease MUS81 from Arabidopsis with 61.63% of identity |
Eggnog | Excision repair cross-complementing rodent repair deficiency, complementation group 4(COG1948) |
Kegg | Link to kegg annotations (AT4G30870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427613.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer