Protein coding transcript 143663

• Transcript: Ll_transcript_109643
• CDS coordinates: 156-1040 (+)
• Peptide sequence: MNFFAGLLLLLMPEENAFWTFVGIIDDYFEGYYTEEMIESQVDQLVFEELMRERFPKLVNHLDYLGVQVAWISGPWFLSIFMNMIPWESVLRVWDVVLFEGNRVMLFRTALALMELYGPALVTTKDAGDAITLLQSLAGSTFDSSQLVFTACMGYLAVTEERLQELREKHRPSVLDVVEERARKGRVWKDSKGLASKLYSFKHDQAPLVEERKPIEGGDMVADEDKSQLESRSSNIDELLNSLNVDSELDALPDVQDQVASSRPHTPTPSHQNLAMFVRLIEIYLSLNSNMTYKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_109643

• Blastp: Putative GTPase-activating protein AN11010 from Aspergillus with 31.02% of identity
• Blastx: TBC1 domain family member 8 from Mus with 40.8% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN7784.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429008.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;