| Transcript | Ll_transcript_109609 |
|---|---|
| CDS coordinates | 2-502 (+) |
| Peptide sequence | QAIPIPSFSNNNHHSHYSFFIKYLFIFLFFYILPHTSFHSLLPLFKNTIFSLQMNSAKGKGKYKDIVIGGDSGSSSRTKSIHPPIETHWSLPNCEGKRTSSFLIKSLLSYPLMKLRRSKSMQVILEGARDSRDAQVVEDFRKMLFIEGLLPPQQNDYHTLLRYLCI* |
| ORF Type | 5prime_partial |
| Blastp | Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 from Arabidopsis with 43.42% of identity |
|---|---|
| Blastx | - |
| Eggnog | Transfer protein(ENOG410XRSQ) |
| Kegg | Link to kegg annotations (AT2G18180) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424552.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer