Transcript | Ll_transcript_109259 |
---|---|
CDS coordinates | 2-631 (+) |
Peptide sequence | ATVLCGQVRVLVVGDSGVGKTSLVHLLVKGSPVARPPQTIGCTVSVKHTTYGNSGSSSSSLKGDSGRDFFVELWDVSGHELYHDCRSLFYSQINGVIFVHDLSQRRTKASLQKWAAEIAATGTFSAPFGFGGPGGLPVPFIVIGNKADIAAKEGTGGSSGNLVDVARQWVEKQGLLPSSEDLPLTESFPSTGGLISVSGSTEFFCQGLC* |
ORF Type | 5prime_partial |
Blastp | Small GTPase LIP1 from Arabidopsis with 80.1% of identity |
---|---|
Blastx | Small GTPase LIP1 from Arabidopsis with 80.1% of identity |
Eggnog | RAB, member of RAS oncogene family-like 3(ENOG410YR8H) |
Kegg | Link to kegg annotations (AT5G64813) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462512.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer