Protein coding transcript 143767

• Transcript: Ll_transcript_109394
• CDS coordinates: 480-1304 (+)
• Peptide sequence: MPEVRIIAKNFMDMVASMPAMKLDKLYENGFICEAILRSLPPLAKKYVLQQLHIDVPVAAKQLEEWVLPDGFSKHRVAIDRLVQLRVFVEAVDRKNEKTYKVTPTFQRSLQKLLVHGGTLPREPMASNITVRLPTLEDLEAWALEQWECFLLQLISSSQVEKPSNISSSLMKVFQRRLLSQRDRDAPKLTESGFQFLLMNTNAQLWYIIREYISNSEERGVDAADLISFMLEISFHVIGEGRKESWFIPTKLATNLSVSLADSSSRKEGFVVVET
• ORF Type: 3prime_partial

Annotations of Ll_transcript_109394

• Blastp: RNA polymerase II transcription factor B subunit 2 from Arabidopsis with 67.99% of identity
• Blastx: RNA polymerase II transcription factor B subunit 2 from Arabidopsis with 67.99% of identity
• Eggnog: Transcription factor(COG5144)
• Kegg: Link to kegg annotations (AT4G17020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424039.1)
• Pfam: Transcription factor Tfb2 (PF03849.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;