Protein coding transcript 1438

• Transcript: Ll_transcript_459413
• CDS coordinates: 184-873 (+)
• Peptide sequence: MEEGKGRVCVTGGGGFIASMLIKRLLQEGYSVNTTVRPGKSKKDLSFLTNLPGASRTLQVFNADLNNPESFIPAIEGCIGVFHTATPYDLQKDEDEEILTKRAIGGALGILKASISSKTVKRVVYTGSAAAIINSGKEVEDIDESYWSDIDFMYKTKPFAWTIAISQTLTEKAVLEFAAQHEHELDVVTLILPYVIGPFICSKLPDSVQFAFPWLFGMFYNMFLYYYQH*
• ORF Type: complete

Annotations of Ll_transcript_459413

• Blastp: Vestitone reductase from Medicago with 59.17% of identity
• Blastx: Vestitone reductase from Medicago with 57.14% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB41550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440642.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;