Transcript | Ll_transcript_109664 |
---|---|
CDS coordinates | 105-578 (+) |
Peptide sequence | MNGLSPSDYVLSAFSNVHSNDLEQTLLALPFSDALKILSYLKEWTSYSDKIELVCRIGTLLLQTHYNQLLSTPIARPVLTAFSDIFYERVKGWKDIFGFNLAAMDHIQQMMASRSDALFSDARSKLLEIRAQQSKRLEERSDLGEAKRKKKPKTTTA* |
ORF Type | complete |
Blastp | WD repeat-containing protein 3 from Homo with 34.68% of identity |
---|---|
Blastx | WD repeat-containing protein 3 from Homo with 33.58% of identity |
Eggnog | WD repeat domain 3(ENOG410XR1C) |
Kegg | Link to kegg annotations (10885) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455410.1) |
Pfam | Dip2/Utp12 Family (PF04003.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer