Protein coding transcript 143883

• Transcript: Ll_transcript_109560
• CDS coordinates: 1144-1608 (+)
• Peptide sequence: MKRINGEANVVAVNAAKEYGIPKFILISVHDYNLPQFLLSNGYFTGKRKAESEVLSKYPGSGIVLRPGFIYGKRRVDGFELPLDLIGEPAEKILKATENFTKPLSSLPASDLLLAPPVSVDDVASAVINGVTDDDFFGIFTIDQIKEAAEKVRA*
• ORF Type: complete

Annotations of Ll_transcript_109560

• Blastp: Uncharacterized protein At1g32220, chloroplastic from Arabidopsis with 75.97% of identity
• Blastx: Uncharacterized protein At1g32220, chloroplastic from Arabidopsis with 76.88% of identity
• Eggnog: epimerase dehydratase(COG0702)
• Kegg: Link to kegg annotations (AT1G32220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424338.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;