Protein coding transcript 143919

• Transcript: Ll_transcript_109445
• CDS coordinates: 1060-1509 (+)
• Peptide sequence: MEGHVKSVLTSETGLEPKEQRLLFKGKEKEHEECLHMVGAKHMSNIVLFEDPASKERKLEEMQKSEEYILKACEAISIIKSEVDKLYQKVLTLETTICGGTKVEEKEFAMLTELLMVQLLKLDSIVANGEAKIQRRVEVSNIFVSLVQP*
• ORF Type: complete

Annotations of Ll_transcript_109445

• Blastp: BAG family molecular chaperone regulator 4 from Arabidopsis with 42.14% of identity
• Blastx: BAG family molecular chaperone regulator 4 from Arabidopsis with 42.14% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT3G51780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460291.1)
• Pfam: BAG domain (PF02179.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;