Protein coding transcript 144025

• Transcript: Ll_transcript_27514
• CDS coordinates: 100-444 (-)
• Peptide sequence: MARKAVRGVDKDYVSKLVGDGILESVEEMKASKQEGVAVYTFSSVTRLGYYENDFGWGKPTWLGTVSKRPNKNTALFFPTRDGEGTEAWITLSKDDMVEFERDPEIVQYTSVDC*
• ORF Type: complete

Annotations of Ll_transcript_27514

• Blastp: Pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase from Salvia with 42.47% of identity
• Blastx: Pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase from Salvia with 31.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAR26385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431320.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;