Protein coding transcript 144074

• Transcript: Ll_transcript_26926
• CDS coordinates: 858-1232 (+)
• Peptide sequence: MAGIPGAYVLWYRPLYRAFRTDSALNYGWFFMFYMLHIGFCILAAVAPPIVFEGKSLTGILSAIDVLNDHAVIGILYFIGFGLFCHEILISIWVIQQVYMNFRGSGKAAKMRHEAARGAVRAAF*
• ORF Type: complete

Annotations of Ll_transcript_26926

• Blastp: Secretory carrier-associated membrane protein 3 from Arabidopsis with 74.8% of identity
• Blastx: Secretory carrier-associated membrane protein from Pisum with 75.44% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (AT1G61250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424910.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;