Protein coding transcript 144077

• Transcript: Ll_transcript_26923
• CDS coordinates: 183-884 (+)
• Peptide sequence: MAGRYDNPFEDEVNPFSKPGSVAPVTNSRPSPFKPERADYNYGFGETVDIALDKSSDLKKKEKELQSKEAELNKREQDLRRKEEAAAGAGIVIEEKNWPPFFPIIHHDIPNEIPVHLQRLQYVAFATYLGITLCLCWNVIAVTAAWIKGGGVKIWLLAIIYLISGVPGGYVLWYRPLYRVFRNENALRFGWFFMIYLLHIGFCIVAAVAPPIVFNGKSLTYVGFTHIYTLFIS*
• ORF Type: complete

Annotations of Ll_transcript_26923

• Blastp: Secretory carrier-associated membrane protein from Pisum with 76.13% of identity
• Blastx: Secretory carrier-associated membrane protein from Pisum with 76.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002274)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422358.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;