Protein coding transcript 144125

• Transcript: Ll_transcript_27475
• CDS coordinates: 193-855 (+)
• Peptide sequence: MSTTSLNHSFFEEQDQIPTQMGFFPFPPNLTLPPLRAFSAMASSENFAGNLPSNTTLHKPRPNLISSLGGQGQLLSLNRSSHVNSWAWGEIADCVMGKSSGGDEHHHQQHLGVSAIKMKKMKNRRKVREPRFCFKTLSEVDVLDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHSPSNELEDSHSPSQLTNFFW*
• ORF Type: complete

Annotations of Ll_transcript_27475

• Blastp: Probable WRKY transcription factor 13 from Arabidopsis with 79.34% of identity
• Blastx: Probable WRKY transcription factor 13 from Arabidopsis with 79.34% of identity
• Eggnog: WRKY DNA -binding domain(ENOG410YMGT)
• Kegg: Link to kegg annotations (AT4G39410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430221.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;