Transcript | Ll_transcript_26889 |
---|---|
CDS coordinates | 381-722 (+) |
Peptide sequence | MSGEDEDPERKGLNLKQYSWRTNFQRDLIAGAMMGGMVHTVVAPIERAKLLLQTQESNLAIVASGRRKFKGMVDCIVRTVREEGILSLWRGNGSSVLRYYPSVALNFSLKVSS* |
ORF Type | complete |
Blastp | Probable ADP,ATP carrier protein At5g56450 from Arabidopsis with 69.3% of identity |
---|---|
Blastx | Probable ADP,ATP carrier protein At5g56450 from Arabidopsis with 76.89% of identity |
Eggnog | transmembrane transport(ENOG410XNW0) |
Kegg | Link to kegg annotations (AT5G56450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437845.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer