Protein coding transcript 144313

• Transcript: Ll_transcript_27176
• CDS coordinates: 438-1088 (+)
• Peptide sequence: MGEPPLKWEILKSIVYGGLLESITSLGIVSSAAGSGAVPLNIVAMGFANLIGGLFIIFHNLIELRNDHSGGDLQQTNFMQEDRYQAQLGRRANFLLHIVVAILSFLIFGSVPIIVYGLLIHKNYSGELKFAVVAVTSIICIILLAIGKVYTKSTPKSYTTTLLRYVTLALAASGVSYIAGGLIDNLLENFNDPKSGFVLTIPSTGTRSVKPAWVPY*
• ORF Type: complete

Annotations of Ll_transcript_27176

• Blastp: Membrane protein of ER body 1 from Arabidopsis with 46.34% of identity
• Blastx: Membrane protein of ER body 1 from Arabidopsis with 45.85% of identity
• Eggnog: VIT family(ENOG41129ND)
• Kegg: Link to kegg annotations (AT4G27860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417207.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;