Transcript | Ll_transcript_26991 |
---|---|
CDS coordinates | 1237-1755 (+) |
Peptide sequence | MFSFSIIYQILMAAGDTFRAAASDQLEIWAERTGCEIVVAESEKAKASSVLVQAVKKGKELGFDIVLCDTSGRLHTNYSLMEELISCKKAVGKVVSGAPNEILLVLDGTTGLNMLPQAREFNEVVGVTGLILTKLDGSARGGCVVFSSFDLNDIFYLVLNKFPLLVLFLVAG* |
ORF Type | complete |
Blastp | Cell division protein FtsY homolog, chloroplastic from Arabidopsis with 88.32% of identity |
---|---|
Blastx | Cell division protein FtsY homolog, chloroplastic from Arabidopsis with 88.32% of identity |
Eggnog | Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC)(COG0552) |
Kegg | Link to kegg annotations (AT2G45770) |
CantataDB | Link to cantataDB annotations (CNT0000908) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461002.1) |
Pfam | SRP54-type protein, GTPase domain (PF00448.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer