Protein coding transcript 144370

• Transcript: Ll_transcript_26994
• CDS coordinates: 1029-1541 (+)
• Peptide sequence: MAAGDTFRAAASDQLEIWAERTGCEIVVAESEKAKASSVLVQAVKKGKELGFDIVLCDTSGRLHTNYSLMEELISCKKAVGKVVSGAPNEILLVLDGTTGLNMLPQAREFNEVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVDAIFA*
• ORF Type: complete

Annotations of Ll_transcript_26994

• Blastp: Cell division protein FtsY homolog, chloroplastic from Arabidopsis with 88.24% of identity
• Blastx: Cell division protein FtsY homolog, chloroplastic from Arabidopsis with 86.93% of identity
• Eggnog: Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC)(COG0552)
• Kegg: Link to kegg annotations (AT2G45770)
• CantataDB: Link to cantataDB annotations (CNT0000926)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461002.1)
• Pfam: SRP54-type protein, GTPase domain (PF00448.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;