Protein coding transcript 144392

• Transcript: Ll_transcript_26809
• CDS coordinates: 1641-2099 (+)
• Peptide sequence: MQVRNDNARKYLKEMRKKSPVPFEEKFPNADPLALRLLQRLLAFDPKDRPTAEEALADPYFYGLAKVEREPSCKPISKLEFEFERRRMTKEDVRGLLYREILEYHPKLLKDYMNGNEGANFLYNTRYKYAFSDYTLCLLPFTDAIVNARNHV*
• ORF Type: complete

Annotations of Ll_transcript_26809

• Blastp: Mitogen-activated protein kinase 8 from Oryza sativa with 64.94% of identity
• Blastx: Mitogen-activated protein kinase 18 from Arabidopsis with 86.88% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (4326853)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449238.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;