Protein coding transcript 144395

• Transcript: Ll_transcript_26812
• CDS coordinates: 229-1035 (+)
• Peptide sequence: MTKEDVRGLLYREILEYHPKLLKDYMNGNEGANFLYNTSAIDQFRKQFVYVEENHGKSGPVLPPERKHVSLPRSTIHSSTIPPSTKSTLALHKNKQTVEEVSKNFRAAGSNFGNQFRGSMLPPRVPAAKPGRVVGPVLHYEDGRNIKDNNDLRIVYQNTPPQAPSSQCFFRTQLTNPKTKSDDKHKDSSQGMNQVPPQQSNLTARPTIDLNTSTYYQQGKNNNLNEPVTVIDPKILQAQSQLGAVDAAAVSVASHSHRYSRGFQYGLS*
• ORF Type: complete

Annotations of Ll_transcript_26812

• Blastp: Mitogen-activated protein kinase 19 from Arabidopsis with 44.32% of identity
• Blastx: Mitogen-activated protein kinase 19 from Arabidopsis with 48.94% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT3G14720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449238.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;