| Transcript | Ll_transcript_27308 |
|---|---|
| CDS coordinates | 212-523 (+) |
| Peptide sequence | MMTKEDETITTAMEQPSEVMTGDNNNDGSKGNNPDEWLNLSLGGTSFSTTGDDDPKSRPATKVFSCNFCMRKFFSSQALGGHQNAHKRERCAIKRCRTQRTMAM |
| ORF Type | 3prime_partial |
| Blastp | Zinc finger protein 7 from Arabidopsis with 51.32% of identity |
|---|---|
| Blastx | Zinc finger protein 7 from Arabidopsis with 60.38% of identity |
| Eggnog | Zinc finger protein(ENOG410YNPP) |
| Kegg | Link to kegg annotations (AT1G24625) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428116.1) |
| Pfam | C2H2-type zinc finger (PF13912.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer