Transcript | Ll_transcript_26877 |
---|---|
CDS coordinates | 595-915 (+) |
Peptide sequence | MLSQLSYNLKITIVGGSIPERSEGRLYNTCCVFGSDGKLKAKHRKIHLFDIDIPGKITFIESKTLSAGETPTIVDTEVGRIGIGICYDIRFPELAMMYAARGLSFN* |
ORF Type | complete |
Blastp | Omega-amidase, chloroplastic from Arabidopsis with 86.27% of identity |
---|---|
Blastx | Omega-amidase, chloroplastic from Arabidopsis with 87.88% of identity |
Eggnog | nitrilase cyanide hydratase and apolipoprotein n-acyltransferase(COG0388) |
Kegg | Link to kegg annotations (AT5G12040) |
CantataDB | Link to cantataDB annotations (CNT0001262) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415643.1) |
Pfam | Carbon-nitrogen hydrolase (PF00795.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer