Transcript | Ll_transcript_469897 |
---|---|
CDS coordinates | 333-956 (+) |
Peptide sequence | MSIFLCVYRDRDAPKLTESGFQFLLMNTNAQLWYIIREYISNSEERGVDAADLISFMLEISFHVIGEAYNVNTLTNFQRNIIKDLADLGLVKLQQGRKESWFIPTKLATNLSVSLADSSSRKEGFVVVETNFRVYAYSTSKLHCEILRLFSRVEYQLPNLIVGAITKESLYNAFDNGITAEQVSNRKQKFNCTISPFKLRYFLNYYR* |
ORF Type | complete |
Blastp | RNA polymerase II transcription factor B subunit 2 from Arabidopsis with 80.11% of identity |
---|---|
Blastx | RNA polymerase II transcription factor B subunit 2 from Arabidopsis with 79.37% of identity |
Eggnog | Transcription factor(COG5144) |
Kegg | Link to kegg annotations (AT4G17020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424039.1) |
Pfam | Transcription factor Tfb2 (PF03849.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer