Protein coding transcript 144544

• Transcript: Ll_transcript_152862
• CDS coordinates: 1828-2331 (+)
• Peptide sequence: MRNATTESRTGLESLLSLYRSTDILQERDRILRCIASSADPNIVVDALNLLLSGEIPDQDIVYVLGGISLECSEVAWRWLKGNWEGILAKYGAGLLLTNFINQIVPLVNSNEKADEIEAFFASNMNPSIVMNLKLSVEQIRIKARWIQSVKQEQSLPDLIKQLAKRN*
• ORF Type: complete

Annotations of Ll_transcript_152862

• Blastp: Aminopeptidase M1 from Arabidopsis with 46.34% of identity
• Blastx: Aminopeptidase M1 from Arabidopsis with 48.91% of identity
• Eggnog: aminopeptidase(COG0308)
• Kegg: Link to kegg annotations (AT4G33090)
• CantataDB: Link to cantataDB annotations (CNT0000134)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425200.1)
• Pfam: ERAP1-like C-terminal domain (PF11838.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;