Protein coding transcript 144664

• Transcript: Ll_transcript_153019
• CDS coordinates: 141-1139 (+)
• Peptide sequence: MNSASNVKVAMSDLLKEIEKLQAVELAKIKFTPACVTELDGFLCNAYVRQCPKPIDYHSRRDLIRIFNVIAKEIYGNNDSSPVVEGYGSFVMDMFNQKSDLDMSINFNHSIRVPRMKMIETLRKFSKKLLKLQRSGHVTGVETILSAKVPIVKVTDRGTGVECDLSVDNRDGIAKSHIIHAVTAIDERFRMLSFLMKSWAQEHNINSSKDRTLNSLSIVSLVAFHLQTCNPPILPPFAALLQEGADLAYVTKVVQTYSNYGKKNQDSLAKLFVTLFVKLALVENYWQKGFCASLYEGSWILKSQGRRSYSISVIQFTYALPFLIGYWTMMLY*
• ORF Type: complete

Annotations of Ll_transcript_153019

• Blastp: Protein HESO1 from Arabidopsis with 36.02% of identity
• Blastx: Protein HESO1 from Arabidopsis with 35.74% of identity
• Eggnog: domain) containing(COG5260)
• Kegg: Link to kegg annotations (AT2G39740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415461.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;