Transcript | Ll_transcript_153019 |
---|---|
CDS coordinates | 141-1139 (+) |
Peptide sequence | MNSASNVKVAMSDLLKEIEKLQAVELAKIKFTPACVTELDGFLCNAYVRQCPKPIDYHSRRDLIRIFNVIAKEIYGNNDSSPVVEGYGSFVMDMFNQKSDLDMSINFNHSIRVPRMKMIETLRKFSKKLLKLQRSGHVTGVETILSAKVPIVKVTDRGTGVECDLSVDNRDGIAKSHIIHAVTAIDERFRMLSFLMKSWAQEHNINSSKDRTLNSLSIVSLVAFHLQTCNPPILPPFAALLQEGADLAYVTKVVQTYSNYGKKNQDSLAKLFVTLFVKLALVENYWQKGFCASLYEGSWILKSQGRRSYSISVIQFTYALPFLIGYWTMMLY* |
ORF Type | complete |
Blastp | Protein HESO1 from Arabidopsis with 36.02% of identity |
---|---|
Blastx | Protein HESO1 from Arabidopsis with 35.74% of identity |
Eggnog | domain) containing(COG5260) |
Kegg | Link to kegg annotations (AT2G39740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415461.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer