Protein coding transcript 14471

• Transcript: Ll_transcript_469819
• CDS coordinates: 169-741 (+)
• Peptide sequence: MKRAISMECLEGRTVVQLENASLLGPSSFQRKSLSFAEVSPIDHDCEKFSQDVVRSKVLSSIKVVVLSTKINLLMPFGPMAILVDNLFDSHGLVFLFCLLGIIPLAERLGYTTEQLALFTGPAVGGLLYATFGNATELIISIHALKSGLIYLVQQSLLGSILSNLLLVLGCALFAGGVVFYKREQAFNRV*
• ORF Type: complete

Annotations of Ll_transcript_469819

• Blastp: Vacuolar cation/proton exchanger 2 from Arabidopsis with 56.57% of identity
• Blastx: Vacuolar cation/proton exchanger 2 from Arabidopsis with 69.42% of identity
• Eggnog: Calcium Proton(COG0387)
• Kegg: Link to kegg annotations (AT3G13320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455594.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;