Protein coding transcript 144800

• Transcript: Ll_transcript_152497
• CDS coordinates: 345-1034 (+)
• Peptide sequence: MGFACSRSVSFDDDPELVEAPASNNDNGIKLKYHIDGRQIAESSSEMAQKKVLRKTRKLLKTRVLSRVFSEDYERVNRRVILDPRGQIINRWNKIFLVACLASLFLDPLFFYLPVVQDQVCIDIGISLEVTLTIIRSVVDLFYIIQIFIKFRTAYVAPSSRVFGRGELVIKSYKIAIRYLKMGFWLDFIAALPIPQVPSWKYFVSYTKLCCCLNMLSVVGVFVYGYFRC*
• ORF Type: complete

Annotations of Ll_transcript_152497

• Blastp: Protein CNGC15c from Medicago with 67.66% of identity
• Blastx: Protein CNGC15c from Medicago with 62.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_2g094860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447859.1)
• Pfam: Ion transport protein (PF00520.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;