| Transcript | Ll_transcript_152491 |
|---|---|
| CDS coordinates | 1921-2397 (+) |
| Peptide sequence | MSYRLGVHDLLKALLPFDLDAFLIGDCSSLGQNLLTSTYVGEIMVAILIATLGLVLFALLIGNMQTYLQSTTVRLEEWRVKRTDAEQWMHHRQLPAELRESVRKYDQYKWLATRGVDEEALLKGLPVDLRRDIKRHLCLELVRGVSHETSNSILVTKK* |
| ORF Type | complete |
| Blastp | Protein CNGC15b from Medicago with 89.83% of identity |
|---|---|
| Blastx | Protein CNGC15c from Medicago with 69.89% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (MTR_4g058730) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447859.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer