Protein coding transcript 145

• Transcript: Ll_transcript_277477
• CDS coordinates: 3-353 (+)
• Peptide sequence: AGYVDPEYMTTYQLTDKSDVYSFGVLLVEIVTGRHPIESNRAISDRVTIRWAMRMLKKGEPVIAMDPRLRRSPASNKAVEKVLKLAFQCLAPSKELRPSMKSCAEVLWVIRKAFRDE
• ORF Type: internal

Annotations of Ll_transcript_277477

• Blastp: Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 60.34% of identity
• Blastx: Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 60.34% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G00330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431723.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;