Transcript | Ll_transcript_152894 |
---|---|
CDS coordinates | 1057-1524 (+) |
Peptide sequence | MVDYNGTLPTRTKANPSSKGSDCSTNNDQVSAGLASNSSESKAPKNGDDDVFSDSDEEETRDTQSRKAASEYRFAAPHQVSEATNDQAGMLHKTDQLSHQHEGRTQNNASVQSTTDDKVHTGPSATMESVRASEFRTIAADASVFSFADEDFESD* |
ORF Type | complete |
Blastp | Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 35.88% of identity |
---|---|
Blastx | Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 77.08% of identity |
Eggnog | dual specificity phosphatase(COG2453) |
Kegg | Link to kegg annotations (AT3G19420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424150.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer