Protein coding transcript 145173

• Transcript: Ll_transcript_26379
• CDS coordinates: 2021-2404 (+)
• Peptide sequence: MGEVAVMHSEPLQLECYGMNRMTENDVHTPKSNEPMPEEESNQSTDDINIIDLQGKGYMEHGCQHYRRRCLIRAPCCDEIFDCHHCHNEAKNDTNIDQKHRHNIPRHQVKQVICSLCGTEQEVLPYV*
• ORF Type: complete

Annotations of Ll_transcript_26379

• Blastp: Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 60.23% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RZFP34 from Oryza sativa with 75.79% of identity
• Eggnog: ring finger and CHY zinc finger(ENOG410XXHF)
• Kegg: Link to kegg annotations (4324695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228094.1)
• Pfam: CHY zinc finger (PF05495.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;